 |
| CAMPSQ3328 | |
| Title : | Duck AvBD9 |
| Source : | Anas platyrhynchos [Domestic duck] |
| Taxonomy : | Animalia, Aves |
| PubMed : | Reference: Liao W, Ma D, Wang R, Han Z, Shao T, Li H, Liu S (2009) mRNA Cloning, Evolutionary Analysis and Biological Characterization of Duck Avian Beta-defensin 10. Acta Veterinaria et Zootechnica Sinica, 2009, 40(9): 1320-1326. |
| Activity : | Antibacterial |
| Gram Nature : | Gram +ve, Gram -ve |
| Target : | Escherichia coli, Lactobacilli acidophilus, Bacillus subtilis, Staphylococcus aureus, Pasteurella multocida. |
| Validated : | Experimentally validated |
| AMP Family : | Defensin |
| Length : | 42 |
Sequence: |
ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS |
| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH | |