CAMPSQ325
Title : Microplusin
GenInfo Identifier : 28864185
Source : Rhipicephalus microplus [Cattle tick]
Taxonomy : Animalia, Arachnida
UniProt: Q86LE5
PDB: 2KNJ
Structure Database : CAMPST183
PubMed : 14642886
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
M. luteus ( MIC = 0.38-0.76 microM )
Validated : Experimentally validated
Comment : No activity detected against gram- bacteria and yeast in the concentration range of 25 micromolar
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0016531 Molecular function Copper chaperone activity IDA
GO:0005506 Molecular function Iron ion binding IDA
GO:0046911 Molecular function Metal chelating activity IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 90
Sequence:
 HHQELCTKGDDALVTELECIRLRISPETNAAFDNAVQQLNCLNRACAYRKMCATNNLEQA
MSVYFTNEQIKEIHDAATACDPEAHHEHDH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India