CAMPSQ298
Title : Enterocin P precursor
GenInfo Identifier : 2612870
Source : Enterococcus faecium
Taxonomy : Monera
UniProt: O30434
PubMed : 9361419
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
L.curvatus ( MIC = 17 ng/ml), L.fermentum ( MIC = 1 ng/ml), L.sake ( MIC = 144 ng/ml), Pediococcus acidalactici ( MIC = 69 ng/ml), P.pntosaceus FBB61 ( MIC = 136 ng/ml), P.pntosaceus FBB63 ( MIC = 18 ng/ml), L.lactis BB24 ( MIC = 22 ng/ml), Enterococcus faecium ( MIC = 2 ng/ml), E. faecalis ( MIC = 238 ng/ml), Staphylococcus carnosus ( MIC = 139 ng/ml), Listeria innocua ( MIC = 395 ng/ml), Bacillus cereus ( MIC = 286 ng/ml), Clostridium sporogenes ( MIC = 4 ng/ml), C, tyrobutyricum 3, 5CT ( MIC = 559 ng/ml), C, tyrobutyricum 1754 ( MIC = 412 ng/ml), Propionibacteruim sp P4 ( MIC = 37 ng/ml), Propionibacteruim sp P6 ( MIC = 26 ng/ml), C.perfringes ( MIC = 4 ng/ml), C.botulinum ( MIC = 259 ng/ml), Listeria monocytogenes7973 ( MIC = 35 ng/ml), Listeria monocytogenes LI5sv1/2 ( MIC = 33 ng/ml), Listeria monocytogenes 5105 ( MIC = 18 ng/ml), Listeria monocytogenes L11sv4 ( MIC = 39 ng/ml), Listeria monocytogenes Scott A ( MIC = 125 ng/ml), St. aureus 137 ( MIC = 190 ng/ml), St. aureus 196E ( MIC = 407 ng/ml), St. aureus 349 ( MIC = 221 ng/ml), St. aureus 361 ( MIC = 294 ng/ml), St. aureus 472 ( MIC = 269 ng/ml)
Validated : Experimentally validated
Comment : No inhibition detected against Lactobacillus acidophilus, L.bulgaricus, L.casei, L.helveticus, L.plantarum, L.reuteri, L.sake 148, L.salivarious, pedicoccus acidilactici 347, P.pentosaceus PCI, Leuconostoc cremoris, Lactococcus cremoris, L lac
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR002633 :
IPR023384 : Bacteriocin_IIa_CS.
IPR023384 :
IPR023388 : Bacteriocin_IIa_dom.
IPR023388 :
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM
BacteriocinH35_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0019835 Biological process Cytolysis IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
Length : 44
Sequence:
ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India