CAMPSQ292
Title : Ginkbilobin
GenInfo Identifier : 25452970
Source : Ginkgo biloba [Ginkgo]
Taxonomy : Plantae
UniProt: P83171
PubMed : 11118300
Activity : Antibacterial, Antifungal, Antiviral
Gram Nature : Gram +ve, Gram -ve
Target :
Botrytis cinerea, Mycosphaerella arachidicola, Fusarium oxysporum, Rhizoctonia solani, Coprinus comatus , Staphylococcus aureus, Pseudomonas aeruginosa, Escherichia coli , HIV-1 reverse transcriptase
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005537 Molecular function Mannose binding IEA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0008285 Biological process Negative regulation of cell population proliferation TAS
Length : 40
Sequence:
ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India