CAMPSQ287
Title : Cecropin-B
GenInfo Identifier : 25089860
Source : Heliothis virescens [Tobacco budworm moth]
Taxonomy : Animalia, Insects
UniProt: P83414
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH33_2 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 33
Sequence:
KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India