CAMPSQ277
Title : Buforin-1
GenInfo Identifier : 2495138
Source : Bufo gargarizans [Asian toad]
Taxonomy : Animalia, Amphibia
UniProt: P55897
PubMed : 8573171
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Bacillus subtilis ( MIC = 4microg/ml), Staphylococcus aureus ( MIC = 4 microg/ml), Streptococcus mutans ( MIC = 8 microg/ml), Streptococcus pneumoniae ( MIC = 4 microg/ml), Pseudomonas putida ( MIC = 4 microg/ml), Escherichia coli ( MIC = 8 microg/ml), Salmonella typhimurium ( MIC = 4 microg/ml), Serratia sp. ( MIC = 8 microg/ml), Candida albicans ( MIC = 4 microg/ml), Cryptococcus neoformans ( MIC = 4 microg/ml), Saccharomyces cerevisiae ( MIC = 4 microg/ml)
Validated : Experimentally validated
InterPro : IPR009072 : Histone-fold.
IPR002119 : Histone_H2A.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0000786 Cellular component Nucleosome IEA
GO:0005634 Cellular component Nucleus IEA
GO:0003677 Molecular function DNA binding IEA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0000786 Cellular component Nucleosome IEA
GO:0005634 Cellular component Nucleus IEA
GO:0003677 Molecular function DNA binding IEA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0030527 Molecular function Structural constituent of chromatin IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IDA
Length : 39
Sequence:
 AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India