CAMPSQ2754
Title : THP-2
Source : Meleagris gallopavo [Common turkey]
Taxonomy : Animalia, Aves
UniProt: P80392
PubMed : 7964174
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Staphylococcus aureus ( MIC = 10.5 microg/ml )
Validated : Experimentally validated
Comment : Inactive against Escherichia coli
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH35_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 36
Sequence:
LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India