CAMPSQ266
Title : Rugosin-C
GenInfo Identifier : 2493349
Source : Rana rugosa [Japanese wrinkled frog]
Taxonomy : Animalia, Amphibia
UniProt: P80956
PubMed : 7612013
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Staphylococcus aureus 209P
Validated : Experimentally validated
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
InterPro : IPR012521 : Antimicrobial_frog_2.
AMP Family : Rugosin
Signature :
ID Type Pattern / HMM
RanateurinH28_16 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 37
Sequence:
GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India