| CAMPSQ255 |
| Title : |
Dolabellanin-B2 |
| GenInfo Identifier : |
24636789 |
| Source : |
Dolabella auricularia [Sea hare] |
| Taxonomy : |
Animalia |
| UniProt: |
P83376 |
| PubMed : |
12590964 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
E. coli JM109 and DH5-alpha, H. influenza IID 983, V. vulnificus RIMD 2219009, S. aureus IID 1677, B. subtilis RIMD 0225014, L. monocytogenes VIU206, S. cerevisiae A581A, S. pombe IFO 1628, C. albicans ATCC 36232 , C. albicans TIMM-1623, C. tropicalis TIM |
| Validated : |
Experimentally validated |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
33 |
Sequence: |
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ |
