CAMPSQ2526 |
Title : |
ASABF-related peptide |
GenInfo Identifier : |
357428701 |
Source : |
Suberites domuncula [Sponge] |
Taxonomy : |
Animalia, Demospongiae |
UniProt: |
G8ADN4 |
PubMed : |
22073005 |
Activity : |
Antibacterial, Antifungal |
Gram Nature : |
Gram +ve, Gram -ve |
Target : |
[[Antimicrobial activity of Non-Adsorbed ASABF : Staphylococcus aureus ( MIC= 1.7+/- 0.5 microg/ml ) , Bacillus subtilis ( MIC= 4.8+/- 0.6 microg/ml ), Micrococcus luteus ( MIC=3.6+/- 1.0 microg/ml ), Pseudomonas aeruginosa ( MIC = 12.4+/-5.5 microg/ml ), E. coli ( MIC = 17.4 6.0 microg/ml ), C. albicans ( MIC = 8.5 4.0microg/ml ), A. niger ( MIC = 12.9+/-4.0 microg/ml )][Antimicrobial activity of Adsorbed ASABF : Staphylococcus aureus ( MIC>20 microg/ml ) , Bacillus subtilis ( MIC>20 microg/ml ), Micrococcus luteus ( MIC>20 microg/ml ), Pseudomonas aeruginosa ( MIC >20 microg/ml ), E. coli ( MIC >20 microg/ml ), C. albicans ( MIC >20 microg/ml ), A. niger ( MIC >20 microg/ml ) |
Hemolytic Activity : |
Present, at 10 microgm/mL of peptide concentration 70% hemolysis was observed |
Validated : |
Experimentally validated |
Pfam : |
PF16839: Antimicrobial25 |
Gene Ontology : |
GO ID |
Ontology |
Definition |
Evidence |
GO:0098542 |
Biological process |
Defense response to other organism |
IEA |
|
Length : |
63 |
Sequence: |
ISCKAGRVGCFASCQVQNCATGYCRGSTCVCSRCGKGTTPFNKFKIWNQLRVLVQKMVDE ERA |