 |
| CAMPSQ2526 | |||||||||
| Title : | ASABF-related peptide | ||||||||
| GenInfo Identifier : | 357428701 | ||||||||
| Source : | Suberites domuncula [Sponge] | ||||||||
| Taxonomy : | Animalia, Demospongiae | ||||||||
| UniProt: | G8ADN4 | ||||||||
| PubMed : | 22073005 | ||||||||
| Activity : | Antibacterial, Antifungal | ||||||||
| Gram Nature : | Gram +ve, Gram -ve | ||||||||
| Target : | [[Antimicrobial activity of Non-Adsorbed ASABF : Staphylococcus aureus ( MIC= 1.7+/- 0.5 microg/ml ) , Bacillus subtilis ( MIC= 4.8+/- 0.6 microg/ml ), Micrococcus luteus ( MIC=3.6+/- 1.0 microg/ml ), Pseudomonas aeruginosa ( MIC = 12.4+/-5.5 microg/ml ), E. coli ( MIC = 17.4 6.0 microg/ml ), C. albicans ( MIC = 8.5 4.0microg/ml ), A. niger ( MIC = 12.9+/-4.0 microg/ml )][Antimicrobial activity of Adsorbed ASABF : Staphylococcus aureus ( MIC>20 microg/ml ) , Bacillus subtilis ( MIC>20 microg/ml ), Micrococcus luteus ( MIC>20 microg/ml ), Pseudomonas aeruginosa ( MIC >20 microg/ml ), E. coli ( MIC >20 microg/ml ), C. albicans ( MIC >20 microg/ml ), A. niger ( MIC >20 microg/ml ) |
||||||||
| Hemolytic Activity : | Present, at 10 microgm/mL of peptide concentration 70% hemolysis was observed |
||||||||
| Validated : | Experimentally validated | ||||||||
| Pfam : |
PF16839: Antimicrobial25 |
||||||||
| Gene Ontology : |
|
||||||||
| Length : | 63 | ||||||||
Sequence: |
ISCKAGRVGCFASCQVQNCATGYCRGSTCVCSRCGKGTTPFNKFKIWNQLRVLVQKMVDE ERA |
||||||||
| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH | |