CAMPSQ2387
Title : Brevinin-2SN1 antimicrobial peptide precursor
GenInfo Identifier : 318055881
Source : Hylarana spinulosa [Fine-spined frog]
Taxonomy : Animalia, Amphibia
UniProt: E7EKH3
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished, 2..>28
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR004275 : Brevinin.
AMP Family : Brevinin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0044179 Biological process Hemolysis in other organism IDA
Length : 75
Sequence:
 MFTMKKPLLFLFFLGTISLSFCEEERGADEDDEVEMTEEEKRGLRDKIKNVAIDVAKGAG
TGVLKALLCQLDKSC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India