| CAMPSQ2230 |
| Title : |
Antibacterial peptide cecropin 1 |
| GenInfo Identifier : |
281022082 |
| Source : |
Plutella xylostella [Diamondback moth] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
D2KD89 |
| Activity : |
Antibacterial |
| Validated : |
Predicted |
| Pfam : |
PF00272 : Cecropin ( Cecropin family )
|
| InterPro : |
IPR000875 : Cecropin.
IPR000875 :
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0019731 |
Biological process |
Antibacterial humoral response |
IEA |
| GO:0050830 |
Biological process |
Defense response to Gram-positive bacterium |
IEA |
| GO:0045087 |
Biological process |
Innate immune response |
IEA |
|
| Length : |
65 |
Sequence: |
MKLSNIFFFVFMAFFAVASVSAAPRWKPFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIA RPTGK |