CAMPSQ2134
Title : Cecropin-B
GenInfo Identifier : 46395902
Source : Anopheles gambiae [African malaria mosquito]
Taxonomy : Animalia, Insects
UniProt: Q8MUF4
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
AMP Family : Cecropin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0045087 Biological process Innate immune response IEA
Length : 34
Sequence:
APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India