CAMPSQ2084
Title : Beta-defensin133
GenInfo Identifier : 84028894
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q30KQ1
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 38
Sequence:
AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India