CAMPSQ2077
Title : Beta-defensin114
GenInfo Identifier : 85540943
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q30KQ6
Activity : Antibacterial
Validated : Experimentally validated
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0001530 Molecular function Lipopolysaccharide binding IDA
GO:0061760 Biological process Antifungal innate immune response IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0045087 Biological process Innate immune response IMP
GO:0031665 Biological process Negative regulation of lipopolysaccharide-mediated signaling pathway IDA
GO:0043407 Biological process Negative regulation of MAP kinase activity IMP
GO:0032720 Biological process Negative regulation of tumor necrosis factor production IMP
GO:0050729 Biological process Positive regulation of inflammatory response IMP
Length : 43
Sequence:
 DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India