CAMPSQ1957
Title : Defensin-7
GenInfo Identifier : 62286495
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q5G859
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR002366 : Defensin_propep.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0002227 Biological process Innate immune response in mucosa IBA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0051673 Biological process Membrane disruption in other organism IBA
Length : 75
Sequence:
 EPLQARADEMPAQKQPPADDQDVVIYFSGDDSSSLQVPGSTKGLICHCRVLYCLFGEHLG
GTSFIHGERYPICCY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India