CAMPSQ194
Title : Dermaseptin B2
GenInfo Identifier : 1706455
Source : Phyllomedusa bicolor [Two-colored leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: P80282
PubMed : 8306981
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Comment : Microsporum canis (IP 1194)(10microg/ml), Tricophyton rubrum (IP 1400-82)(15microg/ml), Arthroderma simii (IP 1063-74)(30microg/ml), Aspergillus fumigatus (IP 1025-70)(
Pfam : PF12121 : DD_K ( Dermaseptin )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR022731 : Dermaseptin.
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH31_4 HMM
DermaseptinH_57 HMM
DermaseptinP31_4 Pattern A-[LM]-W-K-[DT]-[MV]-L-K-K-[IL]-G-T-[MV]-A-L-H-A-G-K-A-A-[FL]-G-A-[AV]-A-D-T-I-S-Q
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 31
Sequence:
AMWKDVLKKIGTVALHAGKAALGAVADTISQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India