CAMPSQ1934
Title : Beta-defensin 118
GenInfo Identifier : 23813949
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q96PH6
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007160 Biological process Cell-matrix adhesion NAS
GO:0042742 Biological process Defense response to bacterium TAS
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0045087 Biological process Innate immune response TAS
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0051673 Biological process Membrane disruption in other organism IDA
GO:0007283 Biological process Spermatogenesis NAS
Length : 43
Sequence:
AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India