CAMPSQ1875
Title : Sperm-associated antigen11
GenInfo Identifier : 114152878
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q8K4N2
Activity : Antibacterial
Gram Nature : Gram-ve
Target :
E. coli
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR007988 : Sperm_Ag_HE2.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0001669 Cellular component Acrosomal vesicle ISO
GO:0009986 Cellular component Cell surface IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0042742 Biological process Defense response to bacterium ISO
GO:0032690 Biological process Negative regulation of interleukin-1 alpha production IDA
GO:0032691 Biological process Negative regulation of interleukin-1 beta production IDA
Length : 52
Sequence:
 PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India