CAMPSQ187
Title : Antimicrobial peptide 1
GenInfo Identifier : 1703271
Source : Mirabilis jalapa [Garden four-o-clock]
Taxonomy : Plantae
UniProt: P25403
PubMed : 1733929 , 7647302
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
Alternaria brassicola ( MIC = 20 microg/ml), Ascochyta pisi ( MIC = 200 microg/ml), Botrytis cinerea ( MIC = 50 microg/ml), Cercospora beticola ( MIC = 10 microg/ml), Colletotrichum lindemuthianum ( MIC = 6 microg/ml), Fusarium culmorum ( MIC = 30 microg/ml), Fusarium oxysporum f.sp.pisi ( MIC = 15 microg/ml), Fusarium oxysporum f.sp.lycopersici ( MIC = 200 microg/ml), Nectria haematococca ( MIC = 15 microg/ml), Phoma betae ( MIC = 25 microg/ml), Pyrenophora tritici-repentis ( MIC = 300 microg/ml), Pyricularia oryzae ( MIC = 6 microg/ml), Rhizoctonia solani ( MIC = 60 microg/ml), Verticillium dahliae ( MIC = 12 microg/ml), Venturia inequalis ( MIC = 12 microg/ml), B.megaterium ( MIC = 6 microg/ml), Sarcina lutea ( MIC = 100 microg/ml)
Validated : Experimentally validated
Comment : Inactive against E. coli, E. carotouora
Pfam : PF11410 : Antifungal_pept ( Antifungal peptide )
InterPro : IPR013006 : Antimicrobial_C6_CS.
IPR009101 : Gurmarin/antifun_pep.
IPR024206 : Gurmarin/antimicrobial_peptd.
AMP Family : Gurmarin
Signature :
ID Type Pattern / HMM
GurmarinH_10 HMM
GurmarinP_10 Pattern C-I-x(3)-[DGN]-x-C-[NQ]-x-[DNS]-[AGV]-x-[PQ]-[GNP]-x-C-C-S-x-[FHY]-C-x(4)-[GN]-x-[GSV]-x-G-x-C-[KR]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IEA
Length : 37
Sequence:
 QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India