CAMPSQ1845
Title : Defensin5
GenInfo Identifier : 12585221
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: P82106
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0002227 Biological process Innate immune response in mucosa IBA
GO:0051673 Biological process Membrane disruption in other organism IBA
Length : 35
Sequence:
 LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India