CAMPSQ1803
Title : Antimicrobial-like protein Bin-1b
GenInfo Identifier : 71153772
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q8VBV2
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E. coli
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0009986 Cellular component Cell surface IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0019732 Biological process Antifungal humoral response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0032690 Biological process Negative regulation of interleukin-1 alpha production IEA
GO:0032691 Biological process Negative regulation of interleukin-1 beta production IEA
Length : 49
Sequence:
DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India