CAMPSQ177
Title : Sperm associated antigen 11 isoform C
GenInfo Identifier : 159106936
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia, Mammals
UniProt: Q8SQD4
PubMed : 15229135
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E.coli ( MIC = 50-100 microg/ml )
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
PF05324 : Sperm_Ag_HE2 ( Sperm antigen HE2 )
InterPro : IPR001855 : Defensin_beta-typ.
IPR007988 : Sperm_Ag_HE2.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IMP
GO:0051838 Biological process Cytolysis by host of symbiont cells IMP
GO:0042742 Biological process Defense response to bacterium IEA
Length : 53
Sequence:
APIIRRIPYYPEVESDLRIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACCLH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India