CAMPSQ1640
Title : Beta-defensin 1
GenInfo Identifier : 61211663
Source : Saguinus oedipus [Cotton-top tamarin]
Taxonomy : Animalia, Mammals
UniProt: Q95M66
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0019898 Cellular component Extrinsic component of membrane ISS
GO:1990742 Cellular component Microvesicle ISS
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042802 Molecular function Identical protein binding ISS
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
Length : 36
Sequence:
DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India