CAMPSQ1574
Title : Defensin-B
GenInfo Identifier : 148872799
Source : Aedes aegypti [Yellowfever mosquito]
Taxonomy : Animalia, Insects
UniProt: P81602
PubMed : 7633471
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 40
Sequence:
ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India