CAMPSQ1551
Title : Antimicrobial peptide 1
GenInfo Identifier : 6225049
Source : Mesembryanthemum crystallinum [ Common iceplant]
Taxonomy : Plantae
UniProt: O81338
Activity : Antibacterial, Antifungal
Validated : Predicted
Pfam : PF11410 : Antifungal_pept ( Antifungal peptide )
InterPro : IPR013006 : Antimicrobial_C6_CS.
IPR009101 : Gurmarin/antifun_pep.
IPR024206 : Gurmarin/antimicrobial_peptd.
AMP Family : Gurmarin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 38
Sequence:
 AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India