CAMPSQ1483
Title : Heliomicin Mutant
GenInfo Identifier : 159162452
Source : Heliothis virescens [Tobacco budworm moth]
Taxonomy : Animalia, Insects
UniProt: P81544
PDB: 1I2U, 1I2V
Structure Database : CAMPST339, CAMPST29
PubMed : 11580275
Activity : Antibacterial, Antifungal
Validated : Predicted
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
IPR002061 : Scorpion_toxinL/defesin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India