CAMPSQ1444
Title : Beta-defensin 4
GenInfo Identifier : 57114023
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q9TT12
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006935 Biological process Chemotaxis ISS
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0005546 Molecular function Phosphatidylinositol-4,5-bisphosphate binding ISS
GO:0061760 Biological process Antifungal innate immune response ISS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide ISS
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006935 Biological process Chemotaxis ISS
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0031640 Biological process Killing of cells of another organism ISS
GO:0051673 Biological process Membrane disruption in another organism ISS
Length : 36
Sequence:
 DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India