CAMPSQ1425
Title : Hypothetical protein
GenInfo Identifier : 15451426
Source : Macaca fascicularis [Crab-eating macaque]
Taxonomy : Animalia, Mammals
UniProt: Q95LR9
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
PF05324 : Sperm_Ag_HE2 ( Sperm antigen HE2 )
InterPro : IPR001855 : Defensin_beta-typ.
IPR007988 : Sperm_Ag_HE2.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 34
Sequence:
 RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India