CAMPSQ142
Title : Termicin
GenInfo Identifier : 13959581
Source : Pseudacanthotermes spiniger
Taxonomy : Animalia, Insects
UniProt: P82321
PDB: 1MM0
Structure Database : CAMPST43
PubMed : 11053427
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
B. megaterium, M. luteus, S. pyogenes, F. culmorum, F. oxysporum, N. crassa, N. haematococca, T. viride, C. albicans, C. neoformans, S. cerevisiae
Validated : Experimentally validated
Pfam : PF11415 : Toxin_37 ( Antifungal peptide termicin )
InterPro : IPR003614 : Scorpion_toxin-like.
IPR024723 : Termicin.
AMP Family : Termicin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 36
Sequence:
ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India