CAMPSQ1325
Title : Beta-defensin 14
GenInfo Identifier : 71152318
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q7TNV9
PubMed : 14718547
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space ISO
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IDA
GO:0060326 Biological process Cell chemotaxis IDA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0005615 Cellular component Extracellular space ISO
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IDA
GO:0060326 Biological process Cell chemotaxis IDA
GO:0042742 Biological process Defense response to bacterium IDA
Length : 45
Sequence:
 FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India