CAMPSQ1285
Title : Sperm associated antigen 11 isoform A
GenInfo Identifier : 159032541
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q9MZ28
Activity : Antimicrobial
Validated : Predicted
Pfam : PF05324 : Sperm_Ag_HE2 ( Sperm antigen HE2 )
InterPro : IPR007988 : Sperm_Ag_HE2.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0009986 Cellular component Cell surface IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0019732 Biological process Antifungal humoral response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0032690 Biological process Negative regulation of interleukin-1 alpha production IEA
GO:0032691 Biological process Negative regulation of interleukin-1 beta production IEA
Length : 43
Sequence:
DLLPPRTPPYQVHISHQEARGPSFKICVGFLGPRWARGCSTGN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India