CAMPSQ1189
Title : Defensin-related cryptdin 4
GenInfo Identifier : 21542397
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: P28311
PDB: 1TV0, 2GW9, 2GWP, 2LEW, 2LEY
Structure Database : CAMPST72, CAMPST562, CAMPST563, CAMPST203, CAMPST204
PubMed : 15595831
Activity : Antibacterial
Validated : Predicted
Pfam : PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042582 Cellular component Azurophil granule ISO
GO:0005615 Cellular component Extracellular space IDA
GO:0043231 Cellular component Intracellular membrane-bounded organelle ISO
GO:0030496 Cellular component Midbody ISO
GO:0005543 Molecular function Phospholipid binding IDA
GO:0042803 Molecular function Protein homodimerization activity ISO
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0045087 Biological process Innate immune response ISO
GO:0002227 Biological process Innate immune response in mucosa IBA
GO:0051873 Biological process Killing by host of symbiont cells ISO
GO:0031640 Biological process Killing of cells of other organism IMP
GO:0051673 Biological process Membrane disruption in other organism IDA
GO:1905710 Biological process Positive regulation of membrane permeability ISO
Length : 32
Sequence:
 GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India