CAMPSQ1182
Title : Diptericin
GenInfo Identifier : 118641
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P24492
PubMed : 2125051 , 11269502
Activity : Antibacterial
Gram Nature : Gram -ve
Validated : Experimentally validated
InterPro : IPR005521 : Attacin_C.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEP
GO:0042742 Biological process Defense response to bacterium ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium IEP
GO:0045087 Biological process Innate immune response IEA
GO:0045089 Biological process Positive regulation of innate immune response HMP
GO:0009617 Biological process Response to bacterium IDA
GO:0055093 Biological process Response to hyperoxia IMP
Length : 83
Sequence:
DDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLG
GPYGNSEPSWKVGSTYTYRFPNF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India