CAMPSQ1180
Title : Defensin
GenInfo Identifier : 1169263
Source : Palomena prasina [Green shield bug]
Taxonomy : Animalia, Insects
UniProt: P80407
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEP
GO:0045087 Biological process Innate immune response IEA
Length : 43
Sequence:
ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India