CAMPSQ117
Title : Platelet basic protein precursor
GenInfo Identifier : 129874
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P02775
PDB: 1F9P, 1NAP, 1TVX
Structure Database : CAMPST506, CAMPST531, CAMPST547
PubMed : 10877842
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
B. subtilis ATCC 6633 ( MIC = 0.4 microM ), E. coli ML35 ( MIC = 3.4 microM ), S. aureus 42D ( MIC = 6.8 microM ), C. neoformans ( MIC = 1.9 microM ), C.glabrata ( MIC = >30 microM )
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
InterPro : IPR001089 : Chemokine_CXC.
IPR018048 : Chemokine_CXC_CS.
IPR001811 : Chemokine_IL8-like_dom.
IPR027223 : PPBP.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0031091 Cellular component Platelet alpha granule IDA
GO:0031093 Cellular component Platelet alpha granule lumen TAS
GO:1904724 Cellular component Tertiary granule lumen TAS
GO:0008009 Molecular function Chemokine activity IBA
GO:0045236 Molecular function CXCR chemokine receptor binding IBA
GO:0005355 Molecular function Glucose transmembrane transporter activity TAS
GO:0008083 Molecular function Growth factor activity IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0070098 Biological process Chemokine-mediated signaling pathway IBA
GO:0042742 Biological process Defense response to bacterium IEA
GO:1904659 Biological process Glucose transmembrane transport TAS
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0051781 Biological process Positive regulation of cell division IEA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0031091 Cellular component Platelet alpha granule IDA
GO:0031093 Cellular component Platelet alpha granule lumen TAS
GO:0008009 Molecular function Chemokine activity IBA
GO:0045236 Molecular function CXCR chemokine receptor binding IBA
GO:0005355 Molecular function Glucose transmembrane transporter activity TAS
GO:0008083 Molecular function Growth factor activity IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0070098 Biological process Chemokine-mediated signaling pathway IBA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of another organism IDA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0051781 Biological process Positive regulation of cell division IEA
Length : 66
Sequence:
 AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQ
KKLAGD

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India