CAMPSQ1148
Title : Ixosin-B
GenInfo Identifier : 261263168
Source : Ixodes sinensis [Hard tick]
Taxonomy : Animalia, Arachnida
UniProt: A7UDM9
PubMed : 18295522
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
S. aureus, E. coli, C. albicans
Hemolytic Activity :
Lacks hemolytic activity against rabbit erythrocytes
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 32
Sequence:
 QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India