CAMPSQ1145
Title : WAMP-1a
GenInfo Identifier : 263406454
Source : Triticum kiharae [Wheat]
Taxonomy : Plantae
UniProt: P85966
PDB: 2LB7
Structure Database : CAMPST201
PubMed : 19583772
Activity : Antifungal
Target :
Bipolaris sorokiniana ( IC50 = 5 microg/ml) , Botrytis cinerea ( IC50 = 20 microg/ml), Fusarium oxysporum ( IC50 = 5 microg/ml), Fusarium solani ( IC50 = 5 microg/ml), Fusarium verticillioides ( IC50 = 30 microg/ml), Neurospora crassa (IC50 = 10 microg/ml)
Validated : Experimentally validated
Pfam : PF00187 : Chitin_bind_1 ( Chitin recognition protein )
InterPro : IPR001002 : Chitin-bd_1.
IPR001002 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0008061 Molecular function Chitin binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India