CAMPSQ1144
Title : Elafin
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P19957
PDB: 2REL
PubMed : 16336202
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S. aureus , P. aeruginosa
Validated : Experimentally validated
Pfam : PF10511 : Cementoin ( Trappin protein transglutaminase binding domain )
PF00095 : WAP ( WAP-type (Whey Acidic Protein) 'four-disulfide core' )
InterPro : IPR002098 : SVP_I.
IPR019541 : Trappin_transglut-bd_rpt.
IPR008197 : WAP-type_4-diS_core.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0001533 Cellular component Cornified envelope IDA
GO:0005829 Cellular component Cytosol TAS
GO:0031012 Cellular component Extracellular matrix TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0004866 Molecular function Endopeptidase inhibitor activity TAS
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IBA
GO:0030280 Molecular function Structural constituent of skin epidermis IDA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0007620 Biological process Copulation IEA
GO:0045087 Biological process Innate immune response IBA
GO:0018149 Biological process Peptide cross-linking IDA
GO:0001533 Cellular component Cornified envelope IDA
GO:0005829 Cellular component Cytosol TAS
GO:0031012 Cellular component Extracellular matrix TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0004866 Molecular function Endopeptidase inhibitor activity TAS
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IBA
GO:0030280 Molecular function Structural constituent of skin epidermis IDA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0007620 Biological process Copulation IEA
GO:0045087 Biological process Innate immune response IBA
GO:0018149 Biological process Peptide cross-linking IDA
Length : 57
Sequence:
 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India