CAMPSQ1127
Title : Diptericin
GenInfo Identifier : 74829145
Source : Sarcophaga peregrina [Flesh fly]
Taxonomy : Animalia, Insects
UniProt: Q9TWW2
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E.coli ( MIC = 6.25 microg/ml ), S.sonnei ( MIC = 12.5 microg/ml)
Validated : Experimentally validated
Comment : Inactive against P.vulgaris, P.rettgeri, P.aeruginosa, B.subtilis, S.aureus, M.luteus, B.megaterium, C.bovis, E.cloacae
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0045087 Biological process Innate immune response IEA
Length : 37
Sequence:
DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India