CAMPSQ1125
Title : Puroindoline-B
GenInfo Identifier : 1709917
Source : Triticum aestivum [Wheat]
Taxonomy : Plantae
UniProt: Q10464
PubMed : 12668449 , 16240178
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
S.aureus, C.michiganensis, E.coli, P.syringae pv phaseoli, A.tumefaciens, E.carotovora subsp carotovora
Validated : Experimentally validated
Pfam : PF00234 : Tryp_alpha_amyl ( Protease inhibitor/seed storage/LTP family )
InterPro : IPR006106 : Allergen/soft/tryp_amyl_inhib.
IPR016140 : Bifunc_inhib/LTP/seed_store.
IPR013771 : Trypsin/amylase_inhib.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0016020 Cellular component Membrane IEA
GO:0045735 Molecular function Nutrient reservoir activity IEA
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0016020 Cellular component Membrane IEA
GO:0045735 Molecular function Nutrient reservoir activity IEA
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 119
Sequence:
 EVGGGGGSQQCPQERPKLSSCKDYVMERCFTMKDFPVTWPTKWWKGGCEHEVREKCCKQL
SQIAPQCRCDSIRRVIQGRLGGFLGIWRGEVFKQLQRAQSLPSKCNMGADCKFPSGYYW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India