CAMPSQ1123
Title : WAP four-disulfide core domain protein12
GenInfo Identifier : 34925434
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q9JHY3
PubMed : 12574366
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( IC90 = 10 microM) , S. aureus ( IC90 = 10 microM)
Validated : Experimentally validated
Pfam : PF00095 : WAP ( WAP-type (Whey Acidic Protein) 'four-disulfide core' )
InterPro : IPR008197 : WAP-type_4-diS_core.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0045087 Biological process Innate immune response IBA
Length : 64
Sequence:
 GGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLPVKDNSEEQIP
QSKV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India