CAMPSQ1099
Title : Hge-scorpine
GenInfo Identifier : 121953382
Source : Hadrurus gertschi [Scorpion]
Taxonomy : Animalia, Arachnida
UniProt: Q0GY40
PubMed : 18030427
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
B.subtilis
Hemolytic Activity :
Has hemolytic activity
Validated : Experimentally validated
Comment : Inactive against S. aureus
Pfam : PF14866 : Toxin_38 ( Potassium channel toxin )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 76
Sequence:
 GWMSEKKVQGILDKKLPEGIIRNAAKAIVHKMAKNQFGCFANVDVKGDCKRHCKAEDKEG
ICHGTKCKCGVPISYL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India