CAMPSQ1062
Title : Vasostatin-1
GenInfo Identifier : 116548
Source : Bos taurus [Bovine]
Taxonomy : Animalia, Mammals
UniProt: P05059
PDB: 1CFK, 1N2Y
PubMed : 10753865
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
M.luteus ( MIC = 2 microM ), B.megaterium ( MIC = 0.2 microM ) , N.crassa ( MIC = 3 microM ) , A.fumigatus ( MIC = 5 microM ) , A. brassicicola ( MIC = 3 microM ) , N.hematococca ( MIC = 1 microM ) , F.culmorum ( MIC = 1 microM ) , F.oxyporum ( MIC = 10 microM ) , S.cerevisiae ( MIC = 10 microM ) , C.albicans ( MIC = 10microM )
Validated : Experimentally validated
Comment : Inactive against B.cereus, B.subtilis, S.pyogenes, M.fortuitum, S.aureus , L.monocytogenes , E.coli, E.cloacae, S.typhimurium, K.pneumoniae , P.aeruginosa , T.mentagrophytes
Pfam : PF01271 : Granin ( Granin (chromogranin or secretogranin) )
InterPro : IPR001819 : Chromogranin_AB.
IPR018054 : Chromogranin_CS.
IPR001990 : Granin.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042583 Cellular component Chromaffin granule IDA
GO:0005576 Cellular component Extracellular region IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0098992 Cellular component Neuronal dense core vesicle ISS
GO:0030141 Cellular component Secretory granule IDA
GO:0030133 Cellular component Transport vesicle IEA
GO:0005509 Molecular function Calcium ion binding IDA
GO:0086030 Biological process Adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation IBA
GO:0019732 Biological process Antifungal humoral response IMP
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0052338 Biological process Disruption by host of symbiont cell wall IDA
GO:0045087 Biological process Innate immune response NAS
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0045576 Biological process Mast cell activation ISS
GO:0002551 Biological process Mast cell chemotaxis ISS
GO:0043303 Biological process Mast cell degranulation ISS
GO:0016525 Biological process Negative regulation of angiogenesis TAS
GO:0033604 Biological process Negative regulation of catecholamine secretion IDA
GO:0046888 Biological process Negative regulation of hormone secretion IDA
GO:0046676 Biological process Negative regulation of insulin secretion IDA
GO:1905183 Biological process Negative regulation of protein serine/threonine phosphatase activity IDA
GO:2000707 Biological process Positive regulation of dense core granule biogenesis ISS
GO:0030155 Biological process Regulation of cell adhesion TAS
Length : 76
Sequence:
 LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKE
LQDLALQGAKERTHQQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India