CAMPSQ106
Title : Hadrurin
GenInfo Identifier : 12585254
Source : Hadrurus aztecus [Mexican scorpion]
Taxonomy : Animalia, Arachnida
UniProt: P82656
PubMed : 10931184
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
S. typhimurium, K. pneumoniae, E. cloacae, P. aeruginosa, E. coli, S. marcescens
Validated : Experimentally validated
Pfam : PF08102 : Antimicrobial_7 ( Scorpion antimicrobial peptide )
InterPro : IPR012526 : Antimicrobial_7.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in another organism IEA
Length : 41
Sequence:
GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India