CAMPSQ1033 |
Title : |
Raphanus Sativus Antifungal Protein 1 |
GenInfo Identifier : |
59798992 |
Source : |
Raphanus sativus var. niger [Chinese radish] |
Taxonomy : |
Plantae |
UniProt: |
P69241 |
PDB: |
1AYJ |
Structure Database : |
CAMPST386 |
PubMed : |
7780308, 1639777 |
Activity : |
Antifungal |
Target : |
[PubMed ID : 7780308 - A. brassicola ( MIC = 15 microg/ml), Botrytis cinerea ( MIC = 8 microg/ml), F. culmorum ( MIC = 5 microg/ml)] [PubMed ID: 1639777 - Alternaria brassicola ( IC50 = 15 g/ml) , Ascochyta pisi ( IC50 = 5 g/ml) , Botrytis cinerea ( IC50 = 8 g/ml) , Cercospora beticola ( IC50 = 2 g/ml) , Colletotrichum lindemuthianum ( IC50 = 100 g/ml) , Fusarium culmorum ( IC50 = 5 g/ml) , Fusarium oxysporum f.sp. lycopersici ( IC50 = 30 g/ml) , Fusarium oxysporum f.sp. pisi ( IC50 = 15 g/ml) , Mycosphaerella fijiensis var. fijiensis ( IC50 = 4 g/ml), Nectria haematococca ( IC50 = 6 g/ml), Phoma betae ( IC50 = 2 g/ml) , Phytophthora infestans ( IC50 = 3 g/ml) , Pyrenophora tritici-repentis ( IC50 = 3 g/ml) , Pyricularia oryzae ( IC50 = 0.3 g/ml) , Rhizoctonia solani ( IC50 = 100 g/ml) , Sclerotinia sclerotiorum ( IC50 = 20 g/ml) , Septoria nodorum ( IC50 = 20 g/ml) , Trichoderma hamatum ( IC50 = 6 g/ml) , Verticillium dahliae ( IC50 = 5 g/ml) |
Validated : |
Experimentally validated |
InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
AMP Family : |
Defensin |
Gene Ontology : |
GO ID |
Ontology |
Definition |
Evidence |
GO:0005576 |
Cellular component |
Extracellular region |
IEA |
GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
Length : |
51 |
Sequence: |
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |