CAMPSQ1033
Title : Raphanus Sativus Antifungal Protein 1
GenInfo Identifier : 59798992
Source : Raphanus sativus var. niger [Chinese radish]
Taxonomy : Plantae
UniProt: P69241
PDB: 1AYJ
Structure Database : CAMPST386
PubMed : 7780308, 1639777
Activity : Antifungal
Target :
[PubMed ID : 7780308 - A. brassicola ( MIC = 15 microg/ml), Botrytis cinerea ( MIC = 8 microg/ml), F. culmorum ( MIC = 5 microg/ml)] [PubMed ID: 1639777 - Alternaria brassicola ( IC50 = 15 g/ml) , Ascochyta pisi ( IC50 = 5 g/ml) , Botrytis cinerea ( IC50 = 8 g/ml) , Cercospora beticola ( IC50 = 2 g/ml) , Colletotrichum lindemuthianum ( IC50 = 100 g/ml) , Fusarium culmorum ( IC50 = 5 g/ml) , Fusarium oxysporum f.sp. lycopersici ( IC50 = 30 g/ml) , Fusarium oxysporum f.sp. pisi ( IC50 = 15 g/ml) , Mycosphaerella fijiensis var. fijiensis ( IC50 = 4 g/ml), Nectria haematococca ( IC50 = 6 g/ml), Phoma betae ( IC50 = 2 g/ml) , Phytophthora infestans ( IC50 = 3 g/ml) , Pyrenophora tritici-repentis ( IC50 = 3 g/ml) , Pyricularia oryzae ( IC50 = 0.3 g/ml) , Rhizoctonia solani ( IC50 = 100 g/ml) , Sclerotinia sclerotiorum ( IC50 = 20 g/ml) , Septoria nodorum ( IC50 = 20 g/ml) , Trichoderma hamatum ( IC50 = 6 g/ml) , Verticillium dahliae ( IC50 = 5 g/ml)
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 51
Sequence:
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India