CAMPSQ1026
Title : Bacteriocin As-48
GenInfo Identifier : 39654340
Source : Enterococcus faecalis
Taxonomy : Monera
UniProt: Q47765
PDB: 1O82 , 1O83 , 1O84
Structure Database : CAMPST357, CAMPST359
PubMed : 14623193
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF09221 : Bacteriocin_IId ( Bacteriocin class IId cyclical uberolysin-like )
InterPro : IPR009086 : Bacteriocin_AS48.
IPR020038 : Bacteriocin_uberolysin.
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 30
Sequence:
AKEFGIPAAVAGTVLNVVEAGGWVTTIVSI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India