 |
| CAMPST856 | |||||||||||
| Title : | NMR structure of Casocidin-I antimicrobial peptide in 60% TFE | ||||||||||
| PDB : | 6FS5 | ||||||||||
| Chain : | A | ||||||||||
| Structure : |
|
||||||||||
| Source : | Bos taurus | ||||||||||
| Experimental Method : | SOLUTION NMR | ||||||||||
| Length : | 39 | ||||||||||
| Activity : | Antimicrobial | ||||||||||
| Sequence database : | CAMPSQ845 | ||||||||||
| Sequence : | KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK |
||||||||||
| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India