CAMPSQ3863
Title : Peptidoglycan recognition protein 4
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q96LB8
PubMed : 16354652
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Bacillus subtilis ( 150-200 microg/ml ), Lactobacillus acidophilus ( 150-200 microg/ml ), Listeria monocytogenes ( 150-200 microg/ml ), Staphylococcus aureus ( 150-200 microg/ml ), Bacillus licheniformis ( 150-200 microg/ml ), Bacillus cereus ( 150-200 microg/ml)
Validated : Experimentally validated
Comment : Inactive against Escherichia coli, Sterptococcus pyogenes, Enterococcus faecalis, Micrococcus luteus
Pfam : PF01510 : Amidase_2 ( N-acetylmuramoyl-L-alanine amidase )
InterPro : IPR002502 : Amidase_domain.
IPR015510 : PGRP.
IPR006619 : PGRP_domain_met/bac.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane NAS
GO:0032991 Cellular component Protein-containing complex IDA
GO:0008745 Molecular function N-acetylmuramoyl-L-alanine amidase activity IEA
GO:0042834 Molecular function Peptidoglycan binding IDA
GO:0016019 Molecular function Peptidoglycan immune receptor activity IDA
GO:0046982 Molecular function Protein heterodimerization activity IPI
GO:0008270 Molecular function Zinc ion binding IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0016045 Biological process Detection of bacterium IDA
GO:0045087 Biological process Innate immune response NAS
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0009253 Biological process Peptidoglycan catabolic process IEA
Length : 255
Sequence:
 MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
WGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFL
VGDDGRVYEGVGWNIQGVHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKG
HLSSSYVQPLLGKGENCLAPRQKTSLKKACPGVVPRSVWGARETHCPRMTLPAKYGIIIH
TAGRTCNISDECRLL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India