CAMPSQ2300
Title : Cathelicidin-OH antimicrobial peptide
GenInfo Identifier : 338817705
Source : Ophiophagus hannah [King cobra]
Taxonomy : Animalia, Reptiles
NCBI Taxonomy : 8665
UniProt: B6S2X2
PubMed : 18620012
Length : 191
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Bacillus
Hemolytic Activity : No hemolytic and cytotoxic activities
Validated : Experimentally Validated
Pfam : PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR000010 : Prot_inh_cystat.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
CAMPCatH34 HMM 34
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0016020 Cellular Component Membrane IEA
GO:0044218 Cellular Component Other organism cell membrane ISS
GO:0004869 Molecular Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0042742 Biological Process Defense response to bacterium ISS
GO:0050832 Biological Process Defense response to fungus ISS
GO:0045087 Biological Process Innate immune response NAS
GO:0031640 Biological Process Killing of cells of other organism ISS
Sequence:
MEGFFWKTLLVVGALAIGGTSSLPHKPLTYEEAVDLAVSIYNSKSGEDSLYRLLEAVPPP
EWDPLSESNQELNFTIKETVCLVAEERSLEECDFQEDGAIMGCTGYYFFGESPPVLVLTC
KPVGEEEEQKQEEGNEEEKEVEKEEKEEDEKDQPRRVKRFKKFFKKLKNSVKKRAKKFFK
KPRVIGVSIPF